Overview

  • Product name

    Recombinant Human YY1AP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGFSNMEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKEL FEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQ LLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIALHHQYNPKFQTL FQPCNLMGAMQLIEDFSTHVSIDCSPHKTVKKTANEFPCLPKQVAWILAT SKVFMYPELLPVCSLKAKNPQDKILFTKAEDNLLALGLKHFEGTEFLNPL ISKYLLTCKTARQLTVRIKNLNMNRAPDNIIKFYKKTKQLPVLGKCCEEI QPHQWKPPIEREEHRLPFWLKASLPSIQEELRHMADGAREVGNMTGTTEI NSDQGLEKDNSELGSETRYPLLLPKGVVLKLKPVADRFPKKAWRQKRSSV LKPLLIQPSPSLQPSFNPGKTPAQSTHSEAPPSKMVLRIPHPIQPATVLQ TVPGVPPLGVSGGESFESPAALPAMPPEARTSFPLSESQTLLSSALVPKV MMPSPASSMFRKPYVRRRPSKRRGARAFRCIKPAPVIHPASVIFTVPATT VKIVSLGGGCNMIQPVNAAVAQSPQTIPIATLLVNPTSFPCPLNQPLVAS SVSPLIVSGNSVNLPIPSTPEDKAHMNVDIACAVADGENAFQGLEPKLEP QELSPLSATVFPKVEHSPGPPPVDKQCQEGLSENSAYRWTVVKTEEGRQA LEPLPQGIQESLNNSSPGDLEEVVKMEPEDATEEISGFL
    • Amino acids

      1 to 739
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ10875
    • FLJ13914
    • GRNG
    • HCCA1
    • HCCA2
    • Hepatocellular carcinoma susceptibility protein
    • Hepatocellular carcinoma-associated protein 2
    • OTTHUMP00000033475
    • OTTHUMP00000033476
    • OTTHUMP00000200831
    • OTTHUMP00000200832
    • OTTHUMP00000200833
    • OTTHUMP00000200836
    • YAP
    • YY1-associated protein 1
    • YY1AP
    • YY1AP1
    • YYAP1_HUMAN
    see all
  • Function

    Enhances transcription activation by YY1. May play a role in cell cycle regulation.
  • Tissue specificity

    Ubiquitous. Detected in small intestine, skeletal muscle, lung, pancreas, brain, stomach, spleen, colon and heart. Detected at very low levels in healthy liver. Highly expressed in most liver carcinomas.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163034 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up