Recombinant Human ZAN protein (ab159808)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant Human ZAN protein
-
Protein lengthProtein fragment
Description
-
NatureRecombinant
-
SourceWheat germ
-
Amino Acid Sequence
-
SpeciesHuman
-
SequenceKEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASG PSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQG
-
Amino acids19 to 113
-
Tagsproprietary tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159808 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
FormLiquid
-
Additional notesProtein concentration is above or equal to 0.05 mg/ml.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- OTTHUMP00000211358
- OTTHUMP00000211359
- OTTHUMP00000211360
see all -
FunctionBinds in a species-specific manner to the zona pellucida of the egg. May be involved in gamete recognition and/or signaling.
-
Tissue specificityIn testis, primarily in haploid spermatids.
-
Sequence similaritiesContains 1 EGF-like domain.
Contains 3 MAM domains.
Contains 4 TIL (trypsin inhibitory-like) domains.
Contains 5 VWFC domains.
Contains 4 VWFD domains. -
DomainThe MAM domains probably mediate sperm adhesion to the zona pellucida.
During sperm migration through the reproductive tracts, the mucin-like domain might inhibit inappropriate trapping of spermatozoa or promoting adhesion to the oviductal isthmus.
The VWFD domain 2 may mediate covalent oligomerization. -
Cellular localizationCell membrane. Exclusively on the apical region of the sperm head.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant Human ZAN protein (ab159808)ab159808 on a 12.5% SDS-PAGE stained with Coomassie Blue.
Datasheets and documents
References
ab159808 has not yet been referenced specifically in any publications.
