Overview

  • Product name

    Recombinant Human ZASC1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MNEYPKKRKRKTLHPSRYSDSSGISRIADGFNGIFSDHCYSVCSMRQPDL KYFDNKDDDSDTETSNDLPKFADGIKARNRNQNYLVPSPVLRILDHTAFS TEKSADIVICDEECDSPESVNQQTQEESPIEVHTAEDVPIAVEVHAISED YDIETENNSSESLQDQTDEEPPAKLCKILDKSQALNVTAQQKWPLLRANS SGLYKCELCEFNSKYFSDLKQHMILKHKRTDSNVCRVCKESFSTNMLLIE HAKLHEEDPYICKYCDYKTVIFENLSQHIADTHFSDHLYWCEQCDVQFSS SSELYLHFQEHSCDEQYLCQFCEHETNDPEDLHSHVVNEHACKLIELSDK YNNGEHGQYSLLSKITFDKCKNFFVCQVCGFRSRLHTNVNRHVAIEHTKI FPHVCDDCGKGFSSMLEYCKHLNSHLSEGIYLCQYCEYSTGQIEDLKIHL DFKHSADLPHKCSDCLMRFGNERELISHLPVHETT
    • Amino acids

      1 to 485
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as ZNF 639. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6230400O18Rik
    • ANC 2H01
    • ANC_2H01
    • MGC157200
    • OTTHUMP00000212173
    • OTTHUMP00000212174
    • OTTHUMP00000212175
    • OTTHUMP00000212195
    • OTTHUMP00000212197
    • ZASC1
    • Zfp639
    • Zinc finger amplified in esophageal squamous cell carcinomas 1
    • Zinc finger protein 639
    • Zinc finger protein ANC 2H01
    • Zinc finger protein ANC_2H01
    • Zinc finger protein ZASC1
    • ZN639_HUMAN
    • ZNF 639
    • Znf639
    • ZNF639 zinc finger protein 639
    see all
  • Function

    Binds DNA and may function as a transcriptional repressor.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 8 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162454 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162454 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up