Recombinant Human ZBTB7A protein (ab132406)

Description

  • Product name

    Recombinant Human ZBTB7A protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPNRRGGVSLPPTPPYPLLCDTHIFSSLFLSLLKGSFLRRQFSYCFYGMV LVPFPSHPPLSLSAPSKCLRIPPLPWGWVTAPRLRSHPSVTGRAVLERKP SVVAERGA
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1 to 108

Specifications

Our Abpromise guarantee covers the use of ab132406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp547O146
    • Factor binding IST protein 1
    • Factor that binds to inducer of short transcripts protein 1
    • FBI-1
    • FBI1
    • HIV-1 1st-binding protein 1
    • HIV-1 inducer of short transcripts binding protein
    • HIV-1 inducer of short transcripts-binding factor 1
    • Leukemia/lymphoma-related factor
    • LRF
    • lymphoma related factor
    • MGC99631
    • POK erythroid myeloid ontogenic factor
    • Pokemon
    • POZ and Krueppel erythroid myeloid ontogenic factor
    • TIP21
    • TTF-I-interacting peptide 21
    • ZBT7A_HUMAN
    • ZBTB7
    • ZBTB7A
    • Zinc finger and BTB domain containing 7A
    • zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcripts binding protein
    • Zinc finger and BTB domain-containing protein 7A
    • Zinc finger protein 857A
    • Zinc finger- and BTB domain-containing protein 7
    • ZNF857A
    see all
  • Function

    Plays a key role in the instruction of early lymphoid progenitors to develop into B lineage by repressing T-cell instructive Notch signals (By similarity). Specifically represses the transcription of the CDKN2A gene. Efficiently abrogates E2F1-dependent CDKN2A transactivation/de-repression. Binds to the consensus sequence 5'-[GA][CA]GACCCCCCCCC-3'.
  • Tissue specificity

    Widely expressed. In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level). In tonsil, expressed in squamous epithelium and germinal center lymphocytes (at protein level). Up-regulated in a subset of lymphomas, as well as in a subset of breast, lung, colon, prostate and bladder carcinomas (at protein level).
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 4 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132406 stained with Coomassie Blue.

References

ab132406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up