Description

  • Product name

    Recombinant Human ZBTB9 protein (His tag)
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab196085 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV SLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLL QLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISA RGGNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEG SELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGP HPLPMTATPRKLPEGESAPLELPAPPALPPKIFYIKQEPFEPKEEISGSG TQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHG NEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRFAVKPKRDR HIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHACPHCGRRFRVH ACFLRHRDLCKGQGWATAHWTYKLEHHHHHH
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      1 to 473
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • 3930402F13Rik
    • DASS-97D12.7
    • MGC23166
    • ZBTB9
    • ZBTB9_HUMAN
    • Zinc finger and BTB domain containing 9
    • Zinc finger and BTB domain containing protein 9
    • Zinc finger and BTB domain-containing protein 9
    • ZNF919
    see all
  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Contains 1 BTB (POZ) domain.
    Contains 2 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab196085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up