Overview

  • Product name

    Recombinant Human ZCH11 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSP NRNSSKKNKQNDICIEKTEVKSCKVNAANLPGPKDLGLVLRDQSHCKAKK FPNSPVKAEKATISQAKSEKATSLQAIAEKSPKSPNSVKAEKASSYQMKS EKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVG GEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKE NSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKVYYVVL VIWGEMCVS
    • Molecular weight

      61 kDa including tags
    • Amino acids

      1 to 309

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp779C1943
    • EC 2.7.7.52
    • FLJ42878
    • KIAA0191
    • PAP associated domain containing 3
    • PAPD3
    • Terminal uridylyltransferase 4
    • TUT4
    • TUT4_HUMAN
    • TUTase 4
    • ZCCHC 11
    • Zcchc11
    • Zinc finger CCHC domain containing 11
    • Zinc finger CCHC domain containing protein 11
    • Zinc finger CCHC domain-containing protein 11
    see all
  • Function

    Uridylyltransferase that acts as a suppressor of microRNA (miRNA) biogenesis by specifically mediating the terminal uridylation of some miRNAs. Catalyzes the 3' uridylation of precursor let-7 (pre-let-7), a miRNA precursor. Uridylated pre-let-7 miRNAs fail to be processed by Dicer and undergo degradation. Degradation of pre-let-7 contributes to the maintenance of embryonic stem (ES) cells and is required for ES cells to maintain pluripotency. Does not bind RNA by itself, recruited to pre-let-7 miRNAs via its interaction with LIN28A and LIN28B. Also catalyzes the 3' uridylation of miR-26A, a miRNA that represses IL6 transcript, leading to abrogate IL6 transcript repression and promote cytokine expression. May also suppress Toll-like receptor-induced NF-kappa-B activity via binding to T2BP. Does not play a role in replication-dependent histone mRNA degradation.
  • Sequence similarities

    Belongs to the DNA polymerase type-B-like family.
    Contains 3 CCHC-type zinc fingers.
    Contains 2 PAP-associated domains.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Cytoplasm. Translocates into the cytoplasm following treatment of the cell with LPS.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131808 stained with Coomassie Blue.

References

ab131808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up