Description

  • Product name

    Recombinant Human ZDHHC21 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILI IIFYGISIFCLVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRP KRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTELLTCYAL MFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYT QLIGIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVFGTRWKILWFIPFR QRQPLRVPYHFANHV
    • Amino acids

      1 to 265
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 9130404H11Rik
    • AL024349
    • D130004H04Rik
    • DHHC 21
    • DNZ1
    • GABA A receptor-associated membrane protein 3
    • HSPC097
    • OTTMUSP00000000336
    • OTTMUSP00000022012
    • Probable palmitoyltransferase ZDHHC21
    • RP23-76J17.1
    • Zinc finger DHHC domain containing protein 21
    see all
  • Relevance

    ZDHHC21 belongs to the DHHC palmitoyltransferase family. The function of this protein has not been specifically defined.
  • Cellular localization

    Membrane; Multi-pass membrane protein

Images

  • ab166279 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up