Overview

  • Product name
    Recombinant Human ZDHHC4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDFLVLFLFYLASVLMGLVLICVCSKTHSLKGLARGGAQIFSCIIPECLQ RAVHGLLHYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHY LLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFLHVYEFDEVMFPKNVR CSTCDLRKPARSKHCSVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLT LTASAATVAIVSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLF LTFPRIVFMLGFVVVLSFLLGGYLLFVLYLAATNQTTNEWYRGDWAWCQR CPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE
    • Amino acids
      1 to 344
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1810021D01Rik
    • 2900029I10Rik
    • DC1
    • DHHC 4
    • DHHC-4
    • FLJ10479
    • MGC108810
    • OTTHUMP00000025197
    • OTTHUMP00000115925
    • OTTHUMP00000115926
    • OTTMUSP00000026321
    • OTTMUSP00000026322
    • Probable palmitoyltransferase ZDHHC4
    • ZDHC4_HUMAN
    • ZDHHC4
    • Zinc finger DHHC domain containing protein 4
    • Zinc finger DHHC domain-containing protein 4
    • Zinc finger protein 374
    • ZNF374
    see all
  • Information by UniProt

Images

  • ab162980 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162980 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up