Overview

  • Product name
    Recombinant Human ZDHHC7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICK RCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSVHALILCGFQFISC VRGQWTECSDFSPPITVILLIFLCLEGLLFFTFTAVMFGTQIHSICNDET EIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLPTRPR KGGPEFSV
    • Amino acids
      1 to 208
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163154 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DHHC 7
    • DHHC7
    • FLJ10792
    • FLJ20279
    • Palmitoyltransferase ZDHHC7
    • ZDHHC 7
    • Zinc finger DHHC domain containing 7
    • Zinc finger DHHC domain containing protein 7
    • Zinc finger DHHC type containing 7
    • Zinc finger protein 370
    • ZNF 370
    • ZNF370
    see all
  • Relevance
    ZDHHC7 is a Palmitoyltransferase with broad specificity which palmitoylates SNAP25 and DLG4/PSD95 and may palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and regulate their synaptic clustering and/or cell surface stability.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab163154 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163154 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163154.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up