Recombinant Human ZDHHC9 protein (ab162420)

Overview

  • Product name
    Recombinant Human ZDHHC9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCT LFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPD EAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPP RASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFA FNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLV ALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG ILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPP EPPEPPQEAAEAEK
    • Amino acids
      1 to 364
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162420 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Antigen MMSA 1
    • Asp His His Cys domain containing protein 9
    • CGI89
    • CXorf11
    • DHHC-9
    • DHHC9
    • MMSA1
    • MRXSZ
    • Palmitoyltransferase ZDHHC9
    • ZDHC9_HUMAN
    • ZDHHC 9
    • ZDHHC10
    • ZDHHC9
    • Zinc finger DHHC domain containing 10
    • Zinc finger DHHC domain containing protein 9
    • Zinc finger DHHC domain-containing protein 9
    • Zinc finger DHHC type containing 9
    • Zinc finger protein 379
    • Zinc finger protein 380
    • ZNF379
    • ZNF380
    see all
  • Function
    The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
  • Tissue specificity
    Highly expressed in kidney, skeletal muscle, brain, lung and liver. Absent in thymus, spleen and leukocytes.
  • Involvement in disease
    Defects in ZDHHC9 are the cause of mental retardation syndromic X-linked ZDHHC9-related (MRXSZ) [MIM:300799]. A disorder characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. Some patients have marfanoid habitus as an additional feature.
  • Sequence similarities
    Belongs to the DHHC palmitoyltransferase family. ERF2/ZDHHC9 subfamily.
    Contains 1 DHHC-type zinc finger.
  • Domain
    The DHHC domain is required for palmitoyltransferase activity.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab162420 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162420 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162420.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up