Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCGSAYQK DIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKC ERAGCRQREMMKLTCERCSRNFCIKHRHPLDHDCSGEGHPTSRAGLAAIS RAQAVASTSTVPSPSQTMPSCTSPSRATTRSPSWTAPPVIALQNGLSEDE ALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSK PSNCSLC
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 257

Specifications

Our Abpromise guarantee covers the use of ab132913 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 1110060O18Rik
    • AIRAP like protein
    • AIRAP-like protein
    • AIRAPL
    • AN1 type zinc finger protein 2B
    • AN1-type zinc finger protein 2B
    • Arsenite inducible RNA associated protein like
    • Arsenite inducible RNA associated protein like protein
    • Arsenite-inducible RNA-associated protein-like protein
    • C81256
    • MGC116391
    • OTTHUMP00000206129
    • OTTHUMP00000206130
    • OTTHUMP00000206132
    • OTTHUMP00000206133
    • RGD1306260
    • Zfand2b
    • ZFN2B_HUMAN
    • Zinc finger AN1 type 2B
    • zinc finger AN1-type domain 2B
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132913, stained with Coomassie Blue.

References

ab132913 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132913.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up