Description

  • Product name

    Recombinant Human ZFP36L1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNTYTRSASFTPKTFTFPLAQNRTSHPTTTSKLKYLGRPSPRRDALQANG EGPEVGPGTEEPAHRLPVGSGSAGEAAASLGTARVRSGRAECTAKLAGDG HARLASAFLHRRAALPPPLGTCRPRLGEGGSAPALGPSPRRGRRVSEGLR DSLPPLGSLTLGKSPK
    • Predicted molecular weight

      45 kDa
    • Amino acids

      1 to 166
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TIS11B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Berg36
    • BRF1
    • Butyrate response factor 1
    • C3H1 type-like 1
    • cMG1
    • EGF-response factor 1
    • ERF-1
    • ERF1
    • Protein TIS11B
    • RNF162B
    • TIS11B
    • TISB_HUMAN
    • ZFP36L1
    • Zinc finger protein 36
    see all
  • Function

    Probable regulatory protein involved in regulating the response to growth factors.
  • Sequence similarities

    Contains 2 C3H1-type zinc fingers.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab166490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up