Overview

  • Product name
    Recombinant Human ZFYVE28 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCT LLVSQFRSCQDNVLNIINQIMDECIPQDRAPRDFCVKFPEEIRHDNLAGQ LWFGAECLAAGSIIMNRELESMAMRPLAKELTRSLEDVRGALRDQALRDL NTYTEKMREALRHFDVLFAEFELSYVSAMVPVKSPREYYVQQEVIVLFCE TVERALDFGYLTQDMIDDYEPALMFSIPRLAIVCGLVVYADGPLNLDRKV EDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLCISQDVEFPIRADV QGPAALAPALSAPLPPEGPLSAKAKDPDAELACSMQYDDQELEQLSRMVH RAGDEMSSLLSPPIACQSPAHRPGAEGSPGGEASPGRPRLRSGSDEEERV FFMDDVEGTAEALARPESPAGPFGWAGSTWADPQEKGQGGPGGAAGISLP ASEKEEDLSNNNLEAEGTDGASLAGTSSCSCLDSRLHLDGWEVGADDAET AEMIAHRTGGMKLSATVIFNPKSPTSLDSAVATQEAASEPVAEGMDGGPH KLSTGATNCLLHSCVCCGSCGDSREDVVERLREKCSPGGVIGASYAAGLA KASDRAPERQEEAPPPSEDASNGREPKAPTSDKCLPHTSGSQVDTASGLQ GEAGVAGQQEPEARELHAGSPPAHEAPQALSGSSSSTAGSCSSDKMGPEA APAATHAAPQATREKIRSRFHGSHDLIHRLFVCISGVADQLQTNYASDLR SILKTLFEVMATKPETDDKEKLRKVTQTLRSAALEDCALCQETLSSSELA AKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCRSCGKIFCSRC SSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL
    • Amino acids
      1 to 887
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hLst2
    • Lateral signaling target protein 2 homolog
    • LST2
    • LST2_HUMAN
    • LYST2
    • MGC43699
    • MGC61592
    • zfyve28
    • Zinc finger FYVE domain containing 28
    • Zinc finger FYVE domain-containing protein 28
    see all
  • Function
    Negative regulator of epidermal growth factor receptor (EGFR) signaling. Acts by promoting EGFR degradation in endosomes when not monoubiquitinated.
  • Sequence similarities
    Belongs to the lst-2 family.
    Contains 1 FYVE-type zinc finger.
  • Domain
    The FYVE-type zinc finger mediates the interaction with phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes when not monoubiquitinated at Lys-87.
  • Post-translational
    modifications
    Monoubiquitination at Lys-87 prevents binding to phosphatidylinositol 3-phosphate (PI3P) and localization to early endosome membranes.
  • Cellular localization
    Cytoplasm > cytosol. Early endosome membrane. Localizes to early endosome membrane in absence of Lys-87 monoubiquitination. Localizes to cytosol when monoubiquitinated.
  • Information by UniProt

Images

  • ab163647 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up