Overview

  • Product name

    Recombinant Human ZIC3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAA AAAAAFKLSPAAAHDLSSGQSSAFTPQGSGYANALGHHHHHHHHHHHTSQ VPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAGSASSLHAP AGIPEPPSYLLFPGLHEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYR PVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQE LSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWE ECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKR THTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHP SSLRKHMKVHESQGSDSSPAASSGYESSTPPAIASANSKDTTKTPSAVQT STSHNPGLPPNFNEWYV
    • Amino acids

      1 to 467
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Heterotaxy 1
    • HTX
    • HTX1
    • VACTERLX
    • ZIC 3
    • Zic family member 3
    • Zic family member 3 (odd paired Drosophila homolog heterotaxy 1)
    • Zic3
    • ZIC3_HUMAN
    • Zinc finger protein 203
    • Zinc finger protein of the cerebellum 3
    • Zinc finger protein ZIC 3
    • Zinc finger protein ZIC 3 (Zinc finger protein of the cerebellum 3)
    • ZNF203
    see all
  • Function

    Acts as transcriptional activator. Required in the earliest stages in both axial midline development and left-right (LR) asymmetry specification. Binds to the minimal GLI-consensus sequence 5'-GGGTGGTC-3'.
  • Involvement in disease

    Heterotaxy, visceral, 1, X-linked
    VACTERL association X-linked with or without hydrocephalus
    Congenital heart defects, multiple types, 1, X-linked
  • Sequence similarities

    Belongs to the GLI C2H2-type zinc-finger protein family.
    Contains 5 C2H2-type zinc fingers.
  • Domain

    The C2H2-type 3, 4 and 5 zinc finger domains are necessary for transcription activation.
  • Cellular localization

    Nucleus. Cytoplasm. Localizes in the cytoplasm in presence of MDFIC overexpression (By similarity). Translocation to the nucleus requires KPNA1 or KPNA6.
  • Information by UniProt

Images

  • ab159826 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up