Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQP MGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGR FGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEA EPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEK KKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAV PPQDTAPYSCHVQHSSLAQPLVVPWEASVDHHHHHH
    • Molecular weight

      33 kDa including tags
    • Amino acids

      21 to 298
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151916 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • Alpha 2 glycoprotein 1 zinc
    • Alpha 2 glycoprotein 1 zinc binding
    • Alpha 2 glycoprotein zinc
    • Azgp1
    • ZA2G
    • ZA2G_HUMAN
    • ZAG
    • Zinc alpha 2 glycoprotein precursor
    • Zinc-alpha-2-glycoprotein
    • Zn alpha 2 glycoprotein
    • Zn alpha 2 GP
    • Zn alpha2 glycoprotein
    • Zn-alpha-2-glycoprotein
    • Zn-alpha-2-GP
    • ZNGP1
    see all
  • Function

    Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. May bind polyunsaturated fatty acids.
  • Tissue specificity

    Blood plasma, seminal plasma, urine, saliva, sweat, epithelial cells of various human glands, liver.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151916 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151916.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up