Recombinant Human Zinc Alpha 2 Glycoprotein (ab207106)

Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PGDYKDDDDKPAGQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQ FFRYNSKDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEY YNDSNGSHVLQGRFGCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPF DPAAQITKQKWEAEPVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPP SVVVTSHQAPGEKKKLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHN GNGTYQSWVVVAVPPQDTAPYSCHVQHSSLAQPLVVPWEAS
    • Molecular weight

      34 kDa including tags
    • Amino acids

      21 to 298
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 21 to 298. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab207106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % Densitometry.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.24% Tris, 0.29% Sodium chloride

    Lyophilised from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of 0.5 mg/mL and let the lyophilised pellet dissolve completely.

General Info

  • Alternative names

    • Alpha 2 glycoprotein 1 zinc
    • Alpha 2 glycoprotein 1 zinc binding
    • Alpha 2 glycoprotein zinc
    • Azgp1
    • ZA2G
    • ZA2G_HUMAN
    • ZAG
    • Zinc alpha 2 glycoprotein precursor
    • Zinc-alpha-2-glycoprotein
    • Zn alpha 2 glycoprotein
    • Zn alpha 2 GP
    • Zn alpha2 glycoprotein
    • Zn-alpha-2-glycoprotein
    • Zn-alpha-2-GP
    • ZNGP1
    see all
  • Function

    Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. May bind polyunsaturated fatty acids.
  • Tissue specificity

    Blood plasma, seminal plasma, urine, saliva, sweat, epithelial cells of various human glands, liver.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12% SDS-PAGE analysis of ab207106.
    Lane 1: Reduced and heated sample, 10μg/lane.
    Lane 2: Non-reduced and non-heated sample, 10μg/lane.

References

ab207106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

The recombinantZinc-alpha-2-glycoprotein is a full length protein identical with the native protein with the exeption of 13 extra amino acids of a purification tag added to the N-terminus of our recombinant protein(PGDYKDDDDK PAG). It isindeed glycosylated.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up