Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      SVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVV PFQAGSRNYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPE
    • Amino acids

      601 to 699
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADP ribosyltransferase diphtheria toxin like 13
    • ARTD13
    • FLB6421
    • PARP13
    • ZAP
    • ZC3H2
    • ZC3HAV 1
    • Zc3hav1
    • ZC3HDC 2
    • ZC3HDC2
    • ZCCHV
    • ZCCHV_HUMAN
    • Zinc finger antiviral protein
    • Zinc finger CCCH domain containing protein 2
    • Zinc finger CCCH domain-containing antiviral protein 1
    • Zinc finger CCCH domain-containing protein 2
    • Zinc finger CCCH type antiviral 1
    • Zinc finger CCCH type antiviral protein 1
    • Zinc finger CCCH-type antiviral protein 1
    see all
  • Function

    Induces an innate immunity to viral infections by preventing the accumulation of viral RNAs in the cytoplasm. Seems to recruit the RNA processing exosome to degrade the target RNAs. Inhibits alphavirus and filovirus replication.
  • Sequence similarities

    Contains 4 C3H1-type zinc fingers.
    Contains 1 PARP catalytic domain.
    Contains 1 WWE domain.
  • Domain

    The second and fourth zinc fingers are involved in binding to specific viral RNAs.
  • Cellular localization

    Cytoplasm. Nucleus. Localizes in the cytoplasm at steady state, but shuttles between nucleus and cytoplasm in a XPO1-dependent manner.
  • Information by UniProt

Images

  • ab153428 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up