Recombinant Human ZIP-10 protein (ab163517)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSK FSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKLLTNLGLGERKVVEIN HEDLGHDHVSHLDILAVQEGKHFHSHNHQHSHNHLNSENQTVTSVSTKRN HKCDPEKETVEVSVKSDDKHMHDHNHRLRHHHRLHHHLDHNNTHHFHNDS ITPSERGEPSNEPSTETNKTQEQSDVKLPKGKRKKKGRKSNENSEVITPG FPPNHDQGEQYEHNRVHKPDRVHNPGHSHVHLPERNGHDPGRGHQDLDPD NEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHG ANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEA NIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGT MSGDALLHLLPHSQGGHDHSHQHAHGHGHSHGHESNKFLEEYDAVLKGLV ALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKL NNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIE EEKIIDHSHSDGLHTIHEHDLHAAAHNHHGENKTVLRKHNHQWHHKHSHH SHGPCHSGSDLKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGI STSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGT AVGQYANNITLWIFAVTAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQ FILQNLGLLFGFAIMLVIALYEDKIVFDIQF
    • Amino acids
      1 to 831
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as SLC39A10.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2900042E17Rik
    • 5430433I10
    • DKFZp781L10106
    • KIAA1265
    • LZT-Hs2
    • MGC126565
    • MGC138428
    • mKIAA1265
    • OTTMUSP00000023810
    • S39AA_HUMAN
    • slc39a10
    • Solute carrier family 39 (metal ion transporter), member 10
    • Solute carrier family 39 (zinc transporter), member 10
    • Solute carrier family 39 member 10
    • Zinc transporter ZIP10
    • ZIP-10
    • ZIP10
    • Zrt- and Irt-like protein 10
    see all
  • Function
    May act as a zinc-influx transporter.
  • Sequence similarities
    Belongs to the ZIP transporter (TC 2.A.5) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163517 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up