Overview

  • Product name

    Recombinant Human ZIP-3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTF GGGVFLATCFNALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSV KALML
    • Amino acids

      1 to 105
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SLC39A3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI845814
    • MGC105842
    • MGC109671
    • MGC7461
    • S39A3_HUMAN
    • SLC
    • Slc39a3
    • Solute carrier family 39 (zinc transporter), member 3
    • Solute carrier family 39 member 3
    • Zinc transporter
    • Zinc transporter ZIP3
    • ZIP-3
    • Zip3
    • Zrt and Irt like protein 3
    • Zrt- and Irt-like protein 3
    see all
  • Function

    Acts as a zinc-influx transporter.
  • Sequence similarities

    Belongs to the ZIP transporter (TC 2.A.5) family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab162300 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up