Overview

  • Product name
    Recombinant Human ZIP-9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTA LAVIVPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHD HTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTL GLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHA GLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVAMLFS AGTFLYVATVHVLPEVGGIGHSHKPDATGGRGLSRLEVAALVLGCLIPLI LSVGHQH
    • Amino acids
      1 to 307
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SLC39A9.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ11274
    • MGC74989
    • PRO1377
    • S39A9_HUMAN
    • SLC39A9
    • Solute carrier family 39 (zinc transporter), member 9
    • Solute carrier family 39 member 9
    • UNQ714
    • Zinc transporter SLC39A9
    • Zinc transporter ZIP9
    • ZIP 9
    • ZIP-9
    • ZIP9
    • Zrt- and Irt-like protein 9
    see all
  • Function
    May act as a zinc-influx transporter.
  • Sequence similarities
    Belongs to the ZIP transporter (TC 2.A.5) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163068 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163068 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163068.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up