Description

  • Product name

    Recombinant Human ZMYND8 protein
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSETQSKAMTMLTIEQLSYLL KFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYG CTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPEC YL
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      160 to 280
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab195163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as PRKCBP1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween, 20% Glycerol

General Info

  • Alternative names

    • CTCL tumor antigen se14 3
    • Cutaneous T cell lymphoma associated antigen se14 3
    • KIAA1125
    • MGC31836
    • predicted protein of HQ2893
    • PRKCBP 1
    • PRO2893
    • Protein kinase C binding protein 1
    • Rack7
    • Zinc finger MYND domain containing protein 8
    • ZMYND 8
    • ZMYND8
    see all
  • Relevance

    PRKCBP1 (protein kinase C binding protein 1) is a receptor for activated C-kinase (RACK) protein. It has been shown to bind in vitro to activated protein kinase C beta I and is also a cutaneous T-cell lymphoma-associated antigen. PRKCBP1 contains a bromodomain and two zinc fingers, and is thought to be a transcriptional regulator. Multiple transcript variants encoding several different isoforms have been found for this gene.
  • Cellular localization

    Nuclear

Images

  • 4-20% SDS-PAGE using of 2 µg ab195163. Coomassie staining.

References

ab195163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab195163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up