Description

  • Product name

    Recombinant Human ZNF169 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKPKLI EQLEQGDEPWREENEHLLDLCPEPRTEFQPSFPHLVAFSSSQLLRQYALS GHPTQIFPSSSAGGDFQLEAPRCSSEKGESGETEGPDSSLRKRPSRISRT FFSPHQGDPVEWVEGNREGGTDLRLAQRMSLGGSDTMLKGADTSESGAVI RGNYRLGLSKKSSLFSHQKHHVCPECGRGFCQRSDLIKHQRTHTGEKPYL CPECGRRFSQKASLSIHQRKHSGEKPYVCRECGRHFRYTSSLTNHKRIHS GERPFVCQECGRGFRQKIALLLHQRTHLEEKPFVCPECGRGFCQKASLLQ HQSSHTGERPFLCLECGRSFRQQSLLLSHQVTHSGEKPYVCAECGHSFRQ KVTLIRHQRTHTGEKPYLCPQCGRGFSQKVTLIGHQRTHTGEKPYLCPDC GRGFGQKVTLIRHQRTHTGEKPYLCPKCGRAFGFKSLLTRHQRTHSEEEL YVDRVCGQGLGQKSHLISDQRTHSGEKPCICDECGRGFGFKSALIRHQRT HSGEKPYVCRECGRGFSQKSHLHRHRRTKSGHQLLPQEVF
    • Amino acids

      1 to 590
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165812 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC51961
    • Zfp169
    • Zinc finger protein 169
    • Znf169
  • Relevance

    ZNF169 belongs to the krueppel C2H2 type zinc finger protein family. It may be involved in transcriptional regulation. It is highly expressed in kidney, weakly expressed in heart, liver, spleen, and small intestine. Not expressed in adult brain or spinal cord. ZNF169 contains thirteen C2H2 type zinc fingers and one KRAB domain.
  • Cellular localization

    Nucleus

Images

  • ab165812 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165812 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165812.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up