Overview

  • Product name
    Recombinant Human ZNF224 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HQEWSFQQIWEKIASDLTRSQDLVINSSQFSKEGDFPCQTEAGLSVIHTR QKSSQGNGYKPSFSDVSHFDFHQQLHSGEKSHTCDECGKNFCYISA
    • Amino acids
      95 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BMZF 2
    • BMZF-2
    • BMZF2
    • Bone marrow zinc finger 2
    • KOX22
    • Zinc finger 2, bone marrow
    • Zinc finger protein 224
    • Zinc finger protein 233
    • Zinc finger protein 255
    • Zinc finger protein 27
    • Zinc finger protein 27 (KOX 22)
    • Zinc finger protein KOX22
    • Zinc finger protein ZNF255
    • ZN224_HUMAN
    • ZNF224
    • ZNF255
    • ZNF27
    see all
  • Function
    May be involved in transcriptional regulation as a transcriptional repressor. The DEPDC1A-ZNF224 complex may play a critical role in bladder carcinogenesis by repressing the transcription of the A20 gene, leading to transport of NF-KB protein into the nucleus, resulting in suppression of apoptosis of bladder cancer cells.
  • Tissue specificity
    Ubiquitous. Mainly expressed in fetal tissues.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 18 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus. Colocalizes with DEPDC1A at the nucleus.
  • Information by UniProt

Images

  • ab159883 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up