Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLENYGNVASLGFPLLKPAVISQLEGGSELGGSSPLAAGTGLQGLQTDIQ TDNDLTKEMYEGKENVSFELQRDFSQETDFSEASLLEKQQEVHSAGNIKK EKSNTIDGTVKDETSPVEECFFSQSSNSYQCHTITGEQPSGCTGLGKSIS FDTKLVKHEIINSEERPFKCEELVEPFRCDSQLIQHQENNTEEKPYQCSE CGKAFSINEKLIWHQRLHSGEKPFKCVECGKSFSYSSHYITHQTIHSGEK PYQCKMCGKAFSVNGSLSRHQRIHTGEKPYQCKECGNGFSCSSAYITHQR VHTGEKPYECNDCGKAFNVNAKLIQHQRIHTGEKPYECNECGKGFRCSSQ LRQHQSIHTGEKPYQCKECGKGFNNNTKLIQHQRIHTGEKPYECTECGKA FSVKGKLIQHQRIHTGEKPYECNECGKAFRCNSQFRQHLRIHTGEKPYEC NECGKAFSVNGKLMRHQRIHTGEKPFECNECGRCFTSKRNLLDHHRIHTG EKPYQCKECGKAFSINAKLTRHQRIHTGEKPFKCMECEKAFSCSSNYIVH QRIHTGEKPFQCKECGKAFHVNAHLIRHQRSHTGEKPFRCVECGKGFSFS SDYIIHQTVHTWKKPYMCSVCGKAFRFSFQLSQHQSVHSEGKS
    • Molecular weight

      100 kDa including tags
    • Amino acids

      1 to 643

Specifications

Our Abpromise guarantee covers the use of ab132770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • KOX16
    • Kruppel like zinc finger factor X31
    • MGC57283
    • OTTHUMP00000174920
    • OTTHUMP00000174921
    • Zfp612
    • Zinc finger protein 23
    • zinc finger protein 32
    • Zinc finger protein 359
    • Zinc finger protein 612
    • Zinc finger protein KOX16
    • ZNF23
    • ZNF23_HUMAN
    • ZNF359
    • ZNF612
    see all
  • Function

    May be involved in transcriptional regulation. May have a role in embryonic development.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 17 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132770 stained with Coomassie Blue.

References

ab132770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up