Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      QRTHSTEKPYECNECEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQK SSLSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHK
    • Amino acids

      445 to 533
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ20755
    • KOX 20
    • KOX20
    • Zinc finger protein 26
    • Zinc finger protein KOX20
    • ZNF 26
    see all
  • Relevance

    ZNF26 (Zinc Finger Protein 26) belongs to the krueppel C2H2-type zinc-finger protein family and contains 7 C2H2-type zinc fingers. It may be involved in transcriptional regulation.
  • Cellular localization

    Nuclear

Images

  • ab159837 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up