Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASRLPTAWSCEPVTFEDVTLGFTPEEWGLLDLKQKSLYREVMLENYRNL VSVEHQLSKPDVVSQLEEAEDFWPVERGIPQDTIPEYPELQLDPKLDPLP AESPLMNIEVVEVLTLNQEVAGPRNAQIQALYAEDGSLSADAPSEQVQQQ GKHPGDPEAARQRFRQFRYKDMTGPREALDQLRELCHQWLQPKARSKEQI LELLVLEQFLGALPVKLRTWVESQHPENCQEVVALVEGVTWMSEEEVLPA GQPAEGTTCCLEVTAQQEEKQEDAAICPVTVLPEEPVTFQDVAVDFSREE WGLLGPTQRTEYRDVMLETFGHLVSVGWETTLENKELAPNSDIPEEEPAP SLKVQESSRDCALSSTLEDTLQGGVQEVQDTVLKQMESAQEKDLPQKKHF DNRESQANSGALDTNQVSLQKIDNPESQANSGALDTNQVLLHKIPPRKRL RKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRI HKGSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQDCGKGFVQSSSL TQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAF RQSSHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQ PTS
    • Molecular weight

      101 kDa including tags
    • Amino acids

      1 to 653

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • SP2114
    • Zf2
    • Zinc finger protein 274
    • Zinc finger protein HFB101
    • Zinc finger protein with KRAB and SCAN domains 19
    • Zinc finger protein zfp2
    • ZKSCAN19
    see all
  • Relevance

    ZNF274 is a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The protein has been suggested to be a transcriptional repressor.
  • Cellular localization

    Nuclear; nucleolus

Images

  • 12.5% SDS-PAGE analysis of ab132594 stained with Coomassie Blue.

References

ab132594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up