Description

  • Product name

    Recombinant Human ZNF3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGN VFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSL KRPLGNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSN LISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKA FSQSSHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYEC NECGKTFSWSSTLTHHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTG EKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQH QRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRV TTELNIREST
    • Amino acids

      1 to 410
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A8 51
    • C2 H2 type zinc finger protein
    • FLJ20216
    • HF.12
    • HZF3.1
    • KOX25
    • PP838
    • Zfp113
    • Zinc finger protein 3
    • Zinc finger protein 3 (A8 51)
    • Zinc finger protein HF.12
    • Zinc finger protein KOX25
    see all
  • Relevance

    A zinc finger is a protein domain that can bind to DNA. A zinc finger consists of two antiparallel ß sheets, and an alpha helix. The structure of each individual finger is highly conserved and consists of about 30 amino acid residues, constructed as a ßßalpha fold and held together by the zinc ion. The alpha helix occurs at the C terminal part of the finger, while the ß sheet occurs at the N terminal part.
  • Cellular localization

    Nuclear

Images

  • ab159829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up