Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAV QAIERKVEIHSRRLLHLEGRTGTAEKKLASCEKTVTELGNQLEGKWAVLG TLLQEYGLLQRRLENLENLLRNRNFWILRLPPGIKGDIPKVPVAFDDVSI YFSTPEWEKLEEWQKELYKNIMKGNYESLISMDYAINQPDVLSQIQPEGE HNTEDQAGPEESEIPTDPSEEPGISTSDILSWIKQEEEPQVGAPPESKES DVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPAAAKDAFSDVAFKS QQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGK NLSQDMLLTHQCSHATEHPLPCAQCPKHFTPQADLSSTSQDHASETPPTC PHCARTFTHPSRLTYHLRVHNSTERPFPCPDCPKRFADQARLTSHRRAHA SERPFRCAQCGRSFSLKISLLLHQRGHAQERPFSCPQCGIDFNGHSALIR HQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFSCPHCGKSFIR KHHLMKHQRIHTGERPYPCSYCGRSFRYKQTLKDHLRSGHNGGCGGDSDP SGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL
    • Amino acids
      1 to 642
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163581 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • P51
    • P71
    • ZER6
    • Zinc finger DNA binding protein p52/p71
    • Zinc finger DNA binding protein ZER6
    • Zinc finger DNA-binding protein p52/p71
    • Zinc finger estrogen receptor interaction, clone 6
    • Zinc finger protein 398
    • ZN398_HUMAN
    • ZNF398
    see all
  • Function
    Function as a transcriptional activator.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 9 C2H2-type zinc fingers.
    Contains 1 KRAB domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163581 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163581 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163581.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up