Description

  • Product name

    Recombinant Human ZNF511 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PLPVERDPAAGAAPFRFVARPVRFPREHQFFEDGDVQRHLYLQDVIMQVA DVPEKPRVPAFACQVAGCCQVFDALDDYEHHYHTLHGNVCSFCKRAFPSG HLLDAHILEWHDSLFQILSERQDMYQCLVEGCTEKFKTSRDRKDHMVRMH LYPADFRFDKPKKSRSPASAEAPGDSGERSEGEAMEICSEPVAASPAPAG ERRIYRHRIPSTICFGQGAARGFKSNKKKTKQC
    • Amino acids

      20 to 252
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165143 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC30006
    • OTTHUMP00000020804
    • Zinc finger protein 511
    • ZNF 511
  • Relevance

    ZNF511 (Zinc finger protein 511) may be involved in transcriptional regulation. It belongs to the krueppel C2H2-type zinc-finger protein family and contains 3 C2H2-type zinc fingers. There are 2 isoforms produced by alternative splicing.
  • Cellular localization

    Nuclear

Images

  • ab165143 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165143 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165143.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up