Overview

  • Product name
    Recombinant Human ZNF513 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRRKQSHPQPVKCEGVKVDTEDSLDEGPGALVLESDLLLGQDLEFEEEE EEEEGDGNSDQLMGFERDSEGDSLGARPGLPYGLSDDESGGGRALSAESE VEEPARGPGEARGERPGPACQLCGGPTGEGPCCGAGGPGGGPLLPPRLLY SCRLCTFVSHYSSHLKRHMQTHSGEKPFRCGRCPYASAQLVNLTRHTRTH TGEKPYRCPHCPFACSSLGNLRRHQRTHAGPPTPPCPTCGFRCCTPRPAR PPSPTEQEGAVPRRPEDALLLPDLSLHVPPGGASFLPDCGQLRGEGEGLC GTGSEPLPELLFPWTCRGCGQELEEGEGSRLGAAMCGRCMRGEAGGGASG GPQGPSDKGFACSLCPFATHYPNHLARHMKTHSGEKPFRCARCPYASAHL DNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSLCN YSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAG GPGLSASEGWAPPHSPPSVLSSRGPPALGTAGSRAVHTDSS
    • Amino acids
      1 to 541
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ32203
    • HMFT0656
    • MGC105911
    • RP58
    • Zfp513
    • Zinc finger protein 513
    • ZN513_HUMAN
    • Znf513
    • Znf513 zinc finger protein 513
    see all
  • Function
    Transcriptional regulator that plays a role in retinal development and maintenance.
  • Tissue specificity
    In the retina, expressed in the outer and inner nuclear layers, and the ganglion cell layer.
  • Involvement in disease
    Defects in ZNF513 are the cause of retinitis pigmentosa type 58 (RP58) [MIM:613617]. A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 8 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165330 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165330.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up