Overview

  • Product name

    Recombinant Human ZNF581 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGEFMLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGP SSSIGSPQASSPPR PNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQ KKCYSCPVCSRVFEYMSYLQRHSITHSEVK PFECDICGKAFKRASHLA RHHSIHLAGGGRPHGCPLCPRRFRDAGELAQHSRVHSGERPFQCPH CP RRFMEQNTLQKHTRWKHP
    • Molecular weight

      24 kDa including tags
    • Amino acids

      1 to 197
    • Tags

      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab169912 was expressed in E.coli as inclusion bodies. The final product was refolded and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names

    • HSPC189
    • Zinc finger protein 581
    • ZN581_HUMAN
    • ZNF581
  • Function

    May be involved in transcriptional regulation.
  • Sequence similarities

    Contains 4 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab169912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up