Description

  • Product name

    Recombinant Human ZNFN1A2/HELIOS protein
    See all ZNFN1A2/HELIOS proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab204211 was refolded using a unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFETEAIDGYITCDNELSPEREH SNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSDEECDRKPLSREDEIR GHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCDVCGMVCI GPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPF CSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYL QNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTGN MGKRKSSTPQKFVGEKLMRFSYPDIHFDMNLTYEKEAELMQSHMMDQAIN NAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRIERPISRET ADSHENNMDGPISLIRPKSRPQEREASPSNSCLDSTDSESSHDDHQSYQG HPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIRAFK CEHCRVLFLDHVMYTIHMGCHGYRDPLECNICGYRSQDRYEFSSHIVRGE HTFH
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      2 to 526
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as ZNFN1A2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.87% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose and DTT.

General Info

  • Alternative names

    • ANF1A2
    • HELIOS
    • IKAROS family zinc finger 2
    • Ikaros family zinc finger protein 2
    • IKZF 2
    • IKZF2
    • IKZF2_HUMAN
    • MGC34330
    • Zinc finger DNA binding protein Helios
    • Zinc finger protein Helios
    • Zinc finger protein subfamily 1A 2
    • ZNF1A2
    see all
  • Function

    Associates with Ikaros at centromeric heterochromatin.
  • Sequence similarities

    Belongs to the Ikaros C2H2-type zinc-finger protein family.
    Contains 6 C2H2-type zinc fingers.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab204211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up