Description

  • Product name

    Recombinant Human ZNHIT1 protein
    See all ZNHIT1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab186091 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVEKKTSVRSQDPGQRRVLDRAARQRRINR QLEALENDNFQDDPHAGLPQLGKRLPQFDDDADTGKKKKKTRGDHFKLRF RKNFQALLEEQNLSVAEGPNYLTACAGPPSRPQRPFCAVCGFPSPYTCVS CGARYCTVRCLGTHQETRCLKWTV
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      1 to 154
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab186091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 50% PBS, 50% Glycerol

    0.2 µM filtered solution

General Info

  • Alternative names

    • CG1I
    • CGBP1
    • Cyclin G1 binding protein 1
    • p18 Hamlet
    • Zinc finger HIT domain containing protein 1
    • Zinc finger protein subfamily 4A member 1
    • zinc finger, HIT type 1
    • ZNFN4A1
    see all
  • Relevance

    ZNHIT1, Zinc finger HIT domain containing protein 1, appears to play a role in p53-mediated apoptosis induction.

References

ab186091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up