Description

  • Product name

    Recombinant Human ZNHIT3 protein
    See all ZNHIT3 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVE KKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESAT LRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPS QNEES
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 155

Specifications

Our Abpromise guarantee covers the use of ab132842 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HNF 4a coactivator
    • Thyroid hormone receptor interactor 3
    • Thyroid receptor interacting protein 3
    • TR interacting protein 3
    • TRIP 3
    • TRIP3
    • Zinc finger HIT domain containing protein 3
    • Zinc finger HIT type 3
    • Zinc finger, HIT domain containing 3
    • Zinc finger, HIT type containing 3
    see all
  • Relevance

    ZNHIT3 functions as a transcriptional coactivator and contains 1 HIT type zinc finger.

Images

  • 12.5% SDS-PAGE analysis of ab132842 stained with Coomassie Blue.

References

ab132842 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132842.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up