Description

  • Product name

    Recombinant Human ZNRF1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMPASRGTGDSERAPGGGGSASDSTYAHGNG YQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSV ASDEMEMHFIMCLSKPRLSYNDDVLTLEHH HHHH*
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      74 to 178
    • Tags

      His tag C-Terminus , His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.88% Sodium chloride, 0.03% EDTA, 10% Glycerol

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • B830022L21Rik
    • DKFZp434E229
    • E3 ubiquitin protein ligase ZNRF1
    • E3 ubiquitin-protein ligase ZNRF1
    • EC 6.3.2.-
    • FLJ14846
    • MGC101991
    • MGC15430
    • Nerve injury gene 283
    • Nerve injury induced gene 283 protein
    • Nerve injury-induced gene 283 protein
    • NIN283
    • Rnf42
    • Zinc and ring finger 1
    • zinc and ring finger protein 1
    • zinc finger and ring finger protein 1
    • Zinc/RING finger protein 1
    • ZNRF 1
    • znrf1
    • ZNRF1_HUMAN
    • Zrfp1
    see all
  • Function

    E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to substrates. May play a role in the establisment and maintenance of neuronal transmission and plasticity via its ubiquitin-protein ligase activity.
  • Tissue specificity

    Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Domain

    The RING-type zinc finger domain is required for E3 ligase activity.
  • Cellular localization

    Endosome. Lysosome. Membrane. Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Associated with synaptic vesicle membranes in neurons.
  • Information by UniProt

References

ab185846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up