Overview

  • Product name
    Recombinant Human ZnT-4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DTVVIILEGVPSHLNVDYIKEALMKIEDVYSVEDLNIWSLTSGKSTAIVH IQLIPGSSSKWEEVQSKANHLLLNTFGMYRCTIQLQSYRQEVDRTCANCQ SSSP
    • Amino acids
      326 to 429
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159885 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SLC30A4. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dri 27 protein
    • Lethal milk protein
    • Slc30a4
    • Solute carrier family 30 (zinc transporter), member 4
    • Solute carrier family 30 member 4
    • Zinc transporter 4
    • ZnT-4
    • Znt4
    • ZNT4_HUMAN
    see all
  • Function
    Probably involved in zinc transport out of the cytoplasm, maybe by sequestration into an intracellular compartment.
  • Sequence similarities
    Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family. SLC30A subfamily.
  • Domain
    Contains a histidine-rich region which is a ligand for zinc and an aspartate-rich region which is a potential ligand for zinc.
  • Cellular localization
    Endosome membrane.
  • Information by UniProt

Images

  • ab159885 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159885 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159885.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up