Description

  • Product name

    Recombinant Human ZP3 protein (His tag)
    See all ZP3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QPLWLLQGGASHPETSVQPVLVECQEATLMVMVSKDLFGTGKLIRAADLT LGPEACEPLVSMDTEDVVRFEVGLHECGNSMQVTDDALVYSTFLLHDPRP VGNLSIVRTNRAEIPIECRYPRQGNVSSQAILPTWLPFRTTVFSEEKLTF SLRLMEENWNAEKRSPTFHLGDAAHLQAEIHTGSHVPLRLFVDHCVATPT PDQNASPYHTIVDFHGCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFAN DSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEGSADICQCC NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGPLIFLDRRG DHEVEQWALPSDTSV
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      23 to 387
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the extracellular domain from aa 23 - 387.

Specifications

Our Abpromise guarantee covers the use of ab226286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • HUMZP3
    • Processed zona pellucida sperm-binding protein 3
    • Sperm receptor
    • Zona pellucida glycoprotein 3
    • zona pellucida glycoprotein 3 (sperm receptor)
    • zona pellucida glycoprotein 3A (sperm receptor)
    • Zona pellucida glycoprotein ZP3
    • Zona pellucida protein C
    • Zona pellucida sperm binding protein 3 precursor
    • Zp-3
    • ZP3
    • ZP3 372
    • ZP3 424
    • ZP3 474
    • ZP3_HUMAN
    • ZP3A
    • ZP3A/ZP3B
    • ZP3B
    • ZPC
    see all
  • Function

    The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation.
  • Tissue specificity

    Oocytes.
  • Sequence similarities

    Belongs to the ZP domain family. ZPC subfamily.
    Contains 1 ZP domain.
  • Domain

    The ZP domain is involved in the polymerization of the ZP proteins to form the zona pellucida.
  • Post-translational
    modifications

    Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.
    N-glycosylated.
    O-glycosylated; removal of O-linked glycans may play an important role in the post-fertilization block to polyspermy.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix and Cell membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab226286 with 5% enrichment gel and 15% separation gel.

References

ab226286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up