Overview

  • Product name

    Recombinant Human ZPR1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESL CMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQG VRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLI TRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPS GNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRN EVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKS GGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGK FTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMK AHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEG YEAGLAPQR
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 459

Specifications

Our Abpromise guarantee covers the use of ab132539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as ZNF259.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MGC110983
    • Zinc finger protein 259
    • Zinc finger protein ZPR1
    • ZNF 259
    • ZNF259
    • ZPR1
    • ZPR1_HUMAN
    see all
  • Function

    May be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus.
  • Sequence similarities

    Belongs to the ZPR1 family.
  • Cellular localization

    Cytoplasm. Nucleus > nucleolus. Translocates to the nucleolus after treatment with mitogens.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab132539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up