Description

  • Product name

    Recombinant Human ZSCAN12 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRKNNTHSREVFRQYFR QFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPE ELQAWVQEQHPESGEEVVTVLEDLERELDEPGEQVSVHTGEQEMFLQETV RLRKEGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVS EEMEPHGKTSSKFENDMSKSARCGETREPEEITEEPSACSREDKQPTCDE NGVSLTENSDHTEHQRICPGEESYGCDDCGKAFSQHSHLIEHQRIHTGDR PYKCEECGKAFRGRTVLIRHKIIHTGEKPYKCNECGKAFGRWSALNQHQR LHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQCNKSFSRRSI LTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGKS FSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCD KCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAFRGITSLIQHQRIHTGE KPYQCDECGKAFRQRKKTSYKEILLKNHSEPQAGVNLLLSSLIPEWQSCF RRDL
    • Amino acids

      1 to 604
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ZNF96

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DJ29K1.2
    • KIAA0426
    • OTTHUMP00000016205
    • ZFP96
    • Zinc finger and SCAN domain containing 12
    • Zinc finger and SCAN domain containing protein 12
    • Zinc finger protein 305
    • Zinc finger protein 96
    • ZNF29K1
    • ZNF305
    • ZNF96
    • ZSCAN12
    see all
  • Relevance

    May be involved in transcriptional regulation.
  • Cellular localization

    Nucleus

Images

  • ab160642 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up