Description

  • Product name

    Recombinant Human ZSCAN4 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MALDLRTIFQCEPSENNLGSENSAFQQSQGPAVQREEGISEFSRMVLNSF QDSNNSYARQELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCND KASVKEKWKSSGKNLERFIEDLTDDSINPPALVHVHMQGQEALFSEDMPL RDVIVHLTKQVNAQTTREANMGTPSQTSQDTSLETGQGYEDEQDGWNSSS KTTRVNENITNQGNQIVSLIIIQEENGPRPEEGGVSSDNPYNSKRAELVT ARSQEGSINGITFQGVPMVMGAGCISQPEQSSPESALTHQSNEGNSTCEV HQKGSHGVQKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFF QISDLRVHQIIHTGKKPFTCSMCKKSFSHKTNLRSHERIHTGEKPYTCPF CKTSYRQSSTYHRHMRTHEKITLPSVPSTPEAS
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 433

Specifications

Our Abpromise guarantee covers the use of ab132741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ35105
    • MGC126787
    • MGC126789
    • Zinc finger and SCAN domain containing 4
    • Zinc finger and SCAN domain containing protein 4
    • Zinc finger and SCAN domain-containing protein 4
    • Zinc finger protein 494
    • ZNF 494
    • ZNF494
    • ZSCA4_HUMAN
    • ZSCAN4
    see all
  • Function

    Embryonic stem (ES) cell-specific transcription factor required to regulate ES cell pluripotency. Binds telomeres and plays a key role in genomic stability in ES cells by regulating telomere elongation. Acts as an activator of spontaneous telomere sister chromatid exchange (T-SCE) and telomere elongation in undifferentiated ES cells.
  • Sequence similarities

    Contains 4 C2H2-type zinc fingers.
    Contains 1 SCAN box domain.
  • Cellular localization

    Nucleus. Chromosome > telomere.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132741 stained with Coomassie Blue.

References

ab132741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up