Description

  • Product name

    Recombinant Human ZWILCH protein
  • Purity

    > 85 % SDS-PAGE.
    ab181888 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMWERLNCAAEDFYSRLLQKFNEEKKGI RKDPFLYEADVQVQLISKGQPNPLKNILNENDIVFIVEKVPLEKEETSHI EELQSEETAISDFSTGENVGPLALPVGKARQLIGLYTMAHNPNMTHLKIN LPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKN YSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIAL DISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLAD GLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKH DTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSL QRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDK LKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSC MPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEK PQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERI FFTNMVTCSQVHFK
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      1 to 591
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_060445

Specifications

Our Abpromise guarantee covers the use of ab181888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • FLJ10036
    • FLJ16343
    • homolog of Drosophila Zwilch
    • hZwilch
    • KNTC1AP
    • MGC111034
    • Protein zwilch homolog
    • ZWILC_HUMAN
    • zwilch
    • zwilch kinetochore protein
    • ZWILCH protein
    • Zwilch, kinetochore associated, homolog
    see all
  • Function

    Essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis. Required for the assembly of the dynein-dynactin and MAD1-MAD2 complexes onto kinetochores. Its function related to the spindle assembly machinery is proposed to depend on its association in the mitotic RZZ complex (PubMed:15824131).
  • Sequence similarities

    Belongs to the ZWILCH family.
  • Cellular localization

    Chromosome, centromere, kinetochore.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3ug ab181888.

References

ab181888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up