Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMEAAETEAEAAALEVLAEVAGILEPVGLQE EAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLA SEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQ LREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEVRERKTG TQQELDGVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLFPEAEA EAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP
    • Molecular weight

      33 kDa including tags
    • Amino acids

      1 to 277
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Human ZW10 interacting protein 1
    • HZwint 1
    • HZwint1
    • KNTC 2 AP
    • KNTC2AP
    • MGC 117174
    • MGC117174
    • ZW10 interacting kinetochore protein
    • ZW10 interacting protein 1
    • ZW10 interactor
    • ZW10 interactor, kinetochore protein
    • ZW10-interacting protein 1
    • ZWINT
    • ZWINT 1
    • Zwint-1
    • ZWINT_HUMAN
    • ZWINT1
    see all
  • Function

    Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase.
  • Information by UniProt

References

ab151360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up