Description

  • Product name

    Recombinant Human ZWINT protein
    See all ZWINT proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMEAAETEAEAAALEVLAEVAGILEPVG LQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLD PLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRK RTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKHLQHLAEVSAEGKLL FPEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDV NLP
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      1 to 230
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001005413.

Specifications

Our Abpromise guarantee covers the use of ab180284 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Human ZW10 interacting protein 1
    • HZwint 1
    • HZwint1
    • KNTC 2 AP
    • KNTC2AP
    • MGC 117174
    • MGC117174
    • ZW10 interacting kinetochore protein
    • ZW10 interacting protein 1
    • ZW10 interactor
    • ZW10 interactor, kinetochore protein
    • ZW10-interacting protein 1
    • ZWINT
    • ZWINT 1
    • Zwint-1
    • ZWINT_HUMAN
    • ZWINT1
    see all
  • Function

    Part of the MIS12 complex, which is required for kinetochore formation and spindle checkpoint activity. Required to target ZW10 to the kinetochore at prometaphase.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180284 (3μg).

References

ab180284 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180284.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up