Recombinant Hydrophobin 2 protein (Tagged) (ab236203)

Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Sequence

      AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKP LCCVAPVADQALLCQKAIGTF
    • Molecular weight

      13 kDa including tags
    • Amino acids

      16 to 86
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Hypocrea jecorina (Trichoderma reesei). This product is the mature full length protein from aa 16 to 86. The signal peptide is not included. N-terminal 10xHis-B2M-JD-tag.

Specifications

Our Abpromise guarantee covers the use of ab236203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab236203.

References

ab236203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up