Description

  • Product name

    Recombinant IL-1RA protein (Animal Free)
    See all IL-1RA proteins and peptides
  • Biological activity

    Inhibition of human IL-1 alpha induced proliferation of D10.G4.1 cells.

    ED50 ≤ 50 ng/ml (≥ 2.0 x 104 units/mg).

  • Purity

    >= 95 % SDS-PAGE.
    Purity determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Sequence

      MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVV PIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFA FIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQ EDE
    • Predicted molecular weight

      17 kDa
    • Amino acids

      26 to 177
    • Additional sequence information

      This product is the mature full length protein from aa 26 to 177. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab229599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • DIRA
    • F630041P17Rik
    • ICIL 1RA
    • ICIL-1RA
    • ICIL1RA
    • IL-1ra
    • IL-1ra3
    • IL-1RN
    • IL1 inhibitor
    • IL1F3
    • IL1RA
    • IL1RA_HUMAN
    • IL1RN
    • IL1RN (IL1F3)
    • Interleukin 1 receptor antagonist
    • Interleukin-1 receptor antagonist protein
    • Intracellular IL 1 receptor antagonist type II
    • Intracellular interleukin 1 receptor antagonist (icIL 1ra)
    • IRAP
    • MGC10430
    • MVCD4
    • Type II interleukin 1 receptor antagonist
    see all
  • Function

    Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling. Has no interleukin-1 like activity. Binds functional interleukin-1 receptor IL1R1 with greater affinity than decoy receptor IL1R2; however, the physiological relevance of the latter association is unsure.
  • Tissue specificity

    The intracellular form of IL1RN is predominantly expressed in epithelial cells.
  • Involvement in disease

    Microvascular complications of diabetes 4
    Interleukin 1 receptor antagonist deficiency
  • Cellular localization

    Cytoplasm and Secreted.
  • Information by UniProt

Images

  • Inhibition of human IL-1 alpha induced proliferation of D10.G4.1 cells.

  • 1 µg ab229599 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab229599 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up