Description

  • Product name

    Recombinant IL-2 protein
    See all IL-2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab209371 was purified by Ion-exchange chromatography.
  • Expression system

    Yeast
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      APTSSSTENTKKQVQSLLQDLHLLLKEINNYENLKLFRMLTFKFYMPKKA TELKHLQCLAEELKPLEDVLNVAQSKTQNSIDIKDLMDNINRIVLTLKGS ETRFTCEYDDETVTAVELLNKWITFCQSIYSTMT
    • Predicted molecular weight

      16 kDa
    • Additional sequence information

      Dolphin

Specifications

Our Abpromise guarantee covers the use of ab209371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    ab209371 was produced in yeast and therefore does not have endotoxin, is naturally folded, and post-translationally modified.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    Constituents: 90% PBS, 10% Trehalose

  • Reconstitution
    Reconstitute with sterile phosphate-buffered saline containing at least 0.1% carrier protein.

General Info

  • Alternative names

    • Aldesleukin
    • IL 2
    • IL-2
    • IL2
    • IL2_HUMAN
    • Interleukin 2
    • Interleukin-2
    • interleukin2
    • Involved in regulation of T cell clonal expansion
    • Lymphokine
    • OTTHUMP00000164090
    • POIL2
    • T Cell Growth Factor
    • T-cell growth factor
    • TCGF
    see all
  • Function

    Produced by T-cells in response to antigenic or mitogenic stimulation, this protein is required for T-cell proliferation and other activities crucial to regulation of the immune response. Can stimulate B-cells, monocytes, lymphokine-activated killer cells, natural killer cells, and glioma cells.
  • Involvement in disease

    Note=A chromosomal aberration involving IL2 is found in a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(4;16)(q26;p13) with involves TNFRSF17.
  • Sequence similarities

    Belongs to the IL-2 family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab209371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab209371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up