Description

  • Product name

    Recombinant Influenza A Avian Influenza A Neuraminidase protein (His tag)
  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Influenza A
    • Sequence

      HSIHTGNQHKAEPISNTNFLTEKAVASVKLAGNSSLCPINGWAVYSKDNS IRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLNDKHSNGTVKDRSPH RTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGAVAV LKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASHKI FKMEKGKVVKSVELDAPNYHYEECSCYPDAGEITCVCRDNWHGSNRPWVS FNQNLEYQIGYICSGVFGDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGN GVWIGRTKSTNSRSGFEMIWDPNGWTETDSSFSVKQDIVAITDWSGYSGS FVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSSISFCGVTSDTVGW SWPDGAELPFTIDK
    • Predicted molecular weight

      46 kDa including tags
    • Amino acids

      36 to 449
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Influenza A [A/Thailand/1(KAN-1)/2004 (H5N1)]

Specifications

Our Abpromise guarantee covers the use of ab219893 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 5% Trehalose, 95% PBS

    Lyophilized from 0.22 µm filtered solution.
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    Reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml.

General Info

  • Alternative names

    • NA
    • Neuraminidase
  • Relevance

    Catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates. Cleaves off the terminal sialic acids on the glycosylated HA during virus budding to facilitate virus release. Additionally helps virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell. Otherwise, infection would be limited to one round of replication. Described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. May facilitate viral invasion of the upper airways by cleaving the sialic acid moities on the mucin of the airway epithelial cells. Likely to plays a role in the budding process through its association with lipid rafts during intracellular transport. May additionally display a raft-association independent effect on budding. Plays a role in the determination of host range restriction on replication and virulence. Sialidase activity in late endosome/lysosome traffic seems to enhance virus replication.
  • Cellular localization

    Cell Membrane; Virion membrane. Apical cell membrane; Single-pass type II membrane protein (By similarity).

Images

  • SDS-PAGE analysis of reduced ab219893 stained overnight with Coomassie Blue.

References

ab219893 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219893.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up