Description

  • Product name

    Recombinant influenza a HA1 (H9N2) protein (Active) (Biotin)
    See all HA1 (H9N2) proteins and peptides
  • Biological activity

    Immobilized Anti-Influenza HA Universal MAb CM2S3 at 5 μg/mL (100 μL/well) can bind ab246113 with a linear range of 1.95-31.25 ng/mL (QC tested).

  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Influenza A
    • Sequence

      DKICIGHQSTNSTETVDTLTETNVPVTHAKELLHTEHNGMLCATSLGHPL ILDTCTIEGLVYGNPSCDLLLEGREWSYIVERSSAVNGTCYPGNVENLEE LRTLFSSASSYQRIQIFPDTTWNVTYTGTSRACSGSFYRSMRWLTQKSGF YPVQDAQYTNNRGKSILFVWGIHHPPTYTEQTNLYIRNDTTTSVTTEDLN RTFKPVIGPRPLVNGLQGRIDYYWSVLKPGQTLRVRSNGNLIAPWYGHVL SGGSHGRILKTDLKSGSCVVQCQTEKGGLNSTLPFHNISKYAFGTCPKYV RVNSLKLAVGLRNVPARSSRGLFGAIAGFIEGGWPGLVAGWYGFQHSNDQ GVGMAADRDSTQKAIDKITSKVNNIVDKMNKQYEIIDHEFSEVETRLNMI NNKIDDQIQDVWAYNAELLVLLENQKTLDEHDANVNNLYNKVKRALGSNA MEDGKGCFELYHKCDDQCMETIRNGTYNRRKYREESRLERQKIEGVKLES EGTYK
    • Predicted molecular weight

      60 kDa including tags
    • Amino acids

      19 to 523
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AAO46082.1. Biotinylated using Avitag™ technology. Briefly, the single lysine residue in the Avitag™ is enzymatically labeled with biotin. Avitag™ sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Hemagglutinin
  • Relevance

    Hemagglutinin (HA) is a class I viral fusion protein from the Influenza virus. It is a major glycoprotein, comprising over 80% of the envelope proteins present in the virus particle. HA binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell, and is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. The HA protein is a homotrimer of disulfide-linked HA1-HA2. It also plays a major role in the determination of host range restriction and virulence. Genetic variation of hemagglutinin and/or neuraminidase genes results in the emergence of new influenza strains. Influenza A subtypes are classified based on the combination of the virus coat glycoproteins, hemagglutinin (HA) and neuraminidase (NA). H9N2 influenza A viruses circulate worldwide. Since the mid-1990s, H9 viruses have become adapted to land-based birds and have crossed sporadically to pigs and humans, causing mild respiratory disease. Importantly, some of the currently circulating H9N2 viruses bind to sialic acid receptors linked to galactose in the {alpha}-2,6 conformation, which is the preferential binding pattern of human influenza viruses. Thus, these H9N2 viruses possess one of the key elements needed to establish stable lineages in humans.
  • Cellular localization

    viral envelope; apical plasma membrane. Associated with glycosphingolipid- and cholesterol-enriched detergent-resistant lipid rafts (By similarity).

Images

  • Reducing SDS-PAGE analysis of ab246113. The protein has a calculated MW of 60 kDa. The protein migrates as 66-70 kDa under reducing conditions (SDS-PAGE).

  • Immobilized Anti-Influenza HA Universal MAb CM2S3 at 5 μg/mL (100 μL/well) can bind ab246113 with a linear range of 1.95-31.25 ng/mL (QC tested).

References

ab246113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up