Overview

  • Product name

    Recombinant Influenza A Hemagglutin HA1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected BTI-TN-5B1-4 cells
  • Amino Acid Sequence
    • Accession
    • Sequence

      ADPMDQICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLDG VKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPANDLCYPGNFN DYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGVPSFFRN VVWLIKKNNTYPTIKRSYNNTNQEDLLILWGIHHSNDAAEQTKLYQNPTT YISVGTSTLNQRLVPKIATRSKVNGQSGRMDFFWTILKPNDAINFESNGN FIAPEYAYKIVKKGDSAIMKSEVEYGNCNTKCQTPIGAINSSMPFHNIHP LTIGECPKYVKSNKLVLATGLRNSPLHHHHHH
    • Molecular weight

      37 kDa including tags
    • Amino acids

      17 to 338
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124542 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab124542 was purified using conventional chromatography.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

Images

  • 15% SDS-PAGE analysis of 3 µg ab124542.

References

ab124542 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124542.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up