Recombinant Influenza A Hemagglutinin protein (His tag) Strain California/07/2009/H1N1 (ab217662)

Description

  • Product name

    Recombinant Influenza A Hemagglutinin protein (His tag) Strain California/07/2009/H1N1
    See all Influenza A Hemagglutinin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 0.010 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Sequence

      DTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCKLRGVAPL HLGKCNIAGWILGNPECESLSTASSWSYIVETPSSDNGTCYPGDFIDYEE LREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIW LVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVF VGSSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVV PRYAFAMERNAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITI GKCPKYVKSTKLRLATGLRNIPSIQSRGHHHHHH
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      18 to 345
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Influenza A virus (H1N1)(A/California/07/2009) (swine flu 2009). C3W5X2-1
  • Description

    Recombinant Influenza A Hemagglutinin protein (His tag)

Specifications

Our Abpromise guarantee covers the use of ab217662 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term.

Images

  • 12% SDS-PAGE analysis of ab217662.

    Lane 1: Reducing condition.

    Lane 2: Non-reducing condition.

References

ab217662 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217662.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up